Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZEB1 monoclonal antibody (M01), clone 4C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,IF-CTC |
More info about ZEB1 monoclonal antibody (M01), clone 4C4
| Brand: | Abnova |
| Reference: | H00006935-M01 |
| Product name: | ZEB1 monoclonal antibody (M01), clone 4C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZEB1. |
| Clone: | 4C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6935 |
| Gene name: | ZEB1 |
| Gene alias: | AREB6|BZP|DELTA-EF1|MGC133261|NIL-2-A|NIL-2A|NIL2A|TCF8|ZEB|ZFHEP|ZFHX1A |
| Gene description: | zinc finger E-box binding homeobox 1 |
| Genbank accession: | NM_030751 |
| Immunogen: | ZEB1 (NP_110378, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE |
| Protein accession: | NP_110378 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re,IF-CTC |
| Shipping condition: | Dry Ice |
| Publications: | The Cytokine IL-6 Reactivates Breast Stromal Fibroblasts through Transcription Factor STAT3-dependent Up-regulation of the RNA Binding Protein AUF1.Hendrayani SF, Al-Khalaf HH, Aboussekhra A J Biol Chem. 2014 Sep 17. pii: jbc.M114.594044. |