TCF3 monoclonal antibody (M01A), clone 5G2 View larger

TCF3 monoclonal antibody (M01A), clone 5G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCF3 monoclonal antibody (M01A), clone 5G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TCF3 monoclonal antibody (M01A), clone 5G2

Brand: Abnova
Reference: H00006929-M01A
Product name: TCF3 monoclonal antibody (M01A), clone 5G2
Product description: Mouse monoclonal antibody raised against a partial recombinant TCF3.
Clone: 5G2
Isotype: IgG2b Kappa
Gene id: 6929
Gene name: TCF3
Gene alias: E2A|ITF1|MGC129647|MGC129648|bHLHb21
Gene description: transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Genbank accession: NM_003200
Immunogen: TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Protein accession: NP_003191
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006929-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006929-M01A-1-25-1.jpg
Application image note: TCF3 monoclonal antibody (M01A), clone 5G2 Western Blot analysis of TCF3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TCF3 monoclonal antibody (M01A), clone 5G2 now

Add to cart