No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00006929-M01 |
| Product name: | TCF3 monoclonal antibody (M01), clone 5G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TCF3. |
| Clone: | 5G2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6929 |
| Gene name: | TCF3 |
| Gene alias: | E2A|ITF1|MGC129647|MGC129648|bHLHb21 |
| Gene description: | transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) |
| Genbank accession: | NM_003200 |
| Immunogen: | TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM |
| Protein accession: | NP_003191 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | TCF3 monoclonal antibody (M01), clone 5G2 Western Blot analysis of TCF3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Synaptic Cross-talk between N-Methyl-D-aspartate Receptors and LAPSER1-{beta}-Catenin at Excitatory Synapses.Schmeisser MJ, Grabrucker AM, Bockmann J, Boeckers TM. J Biol Chem. 2009 Oct 16;284(42):29146-57. Epub 2009 Aug 24. |