No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00006928-M01 |
| Product name: | TCF2 monoclonal antibody (M01), clone 3H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TCF2. |
| Clone: | 3H4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6928 |
| Gene name: | HNF1B |
| Gene alias: | FJHN|HNF1beta|HNF2|HPC11|LF-B3|LFB3|MODY5|TCF2|VHNF1 |
| Gene description: | HNF1 homeobox B |
| Genbank accession: | NM_000458 |
| Immunogen: | TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP |
| Protein accession: | NP_000449 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | TCF2 monoclonal antibody (M01), clone 3H4. Western Blot analysis of TCF2 expression in human skin. |
| Applications: | WB-Ti,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |