No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006926-M03 |
Product name: | TBX3 monoclonal antibody (M03), clone 7H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TBX3. |
Clone: | 7H6 |
Isotype: | IgG1 Kappa |
Gene id: | 6926 |
Gene name: | TBX3 |
Gene alias: | TBX3-ISO|UMS|XHL |
Gene description: | T-box 3 |
Genbank accession: | NM_005996 |
Immunogen: | TBX3 (NP_005987, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK |
Protein accession: | NP_005987 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged TBX3 is approximately 10ng/ml as a capture antibody. |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |