No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
| Brand: | Abnova |
| Reference: | H00006911-M16 |
| Product name: | TBX6 monoclonal antibody (M16), clone 3F11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TBX6. |
| Clone: | 3F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6911 |
| Gene name: | TBX6 |
| Gene alias: | DFNB67 |
| Gene description: | T-box 6 |
| Genbank accession: | NM_004608 |
| Immunogen: | TBX6 (NP_004599, 102 a.a. ~ 200 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNS* |
| Protein accession: | NP_004599 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | TBX6 monoclonal antibody (M16), clone 3F11. Western Blot analysis of TBX6 expression in human pancreas. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |