Brand: | Abnova |
Reference: | H00006907-A01 |
Product name: | TBL1X polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TBL1X. |
Gene id: | 6907 |
Gene name: | TBL1X |
Gene alias: | EBI|SMAP55|TBL1 |
Gene description: | transducin (beta)-like 1X-linked |
Genbank accession: | NM_005647 |
Immunogen: | TBL1X (NP_005638, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK |
Protein accession: | NP_005638 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TBL1X polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of TBL1X expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |