Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 597,25 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 597,25 €
Data sheet of TAZ monoclonal antibody (M02), clone 3A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TAZ monoclonal antibody (M02), clone 3A12
| Brand: | Abnova |
| Reference: | H00006901-M02 |
| Product name: | TAZ monoclonal antibody (M02), clone 3A12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TAZ. |
| Clone: | 3A12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6901 |
| Gene name: | TAZ |
| Gene alias: | BTHS|CMD3A|EFE|EFE2|FLJ27390|G4.5|LVNCX|Taz1|XAP-2 |
| Gene description: | tafazzin |
| Genbank accession: | BC011515 |
| Immunogen: | TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR |
| Protein accession: | AAH11515 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |