| Brand: | Abnova |
| Reference: | H00006890-M02 |
| Product name: | TAP1 monoclonal antibody (M02), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAP1. |
| Clone: | 1B11 |
| Isotype: | IgG3 Kappa |
| Gene id: | 6890 |
| Gene name: | TAP1 |
| Gene alias: | ABC17|ABCB2|APT1|D6S114E|FLJ26666|FLJ41500|PSF1|RING4|TAP1*0102N|TAP1N |
| Gene description: | transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) |
| Genbank accession: | BC014081 |
| Immunogen: | TAP1 (AAH14081, 241 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE |
| Protein accession: | AAH14081 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TAP1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |