No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006890-M01 |
Product name: | TAP1 monoclonal antibody (M01), clone 2B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TAP1. |
Clone: | 2B4 |
Isotype: | IgG3 Kappa |
Gene id: | 6890 |
Gene name: | TAP1 |
Gene alias: | ABC17|ABCB2|APT1|D6S114E|FLJ26666|FLJ41500|PSF1|RING4|TAP1*0102N|TAP1N |
Gene description: | transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) |
Genbank accession: | BC014081 |
Immunogen: | TAP1 (AAH14081, 241 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE |
Protein accession: | AAH14081 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged TAP1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |