No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006885-M04 |
Product name: | MAP3K7 monoclonal antibody (M04), clone 3C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K7. |
Clone: | 3C9 |
Isotype: | IgG2a Kappa |
Gene id: | 6885 |
Gene name: | MAP3K7 |
Gene alias: | TAK1|TGF1a |
Gene description: | mitogen-activated protein kinase kinase kinase 7 |
Genbank accession: | BC017715 |
Immunogen: | MAP3K7 (AAH17715.1, 471 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS |
Protein accession: | AAH17715.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MAP3K7 expression in transfected 293T cell line by MAP3K7 monoclonal antibody (M04), clone 3C9. Lane 1: MAP3K7 transfected lysate(64.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |