| Brand: | Abnova |
| Reference: | H00006884-M02 |
| Product name: | TAF13 monoclonal antibody (M02), clone 2B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF13. |
| Clone: | 2B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6884 |
| Gene name: | TAF13 |
| Gene alias: | MGC22425|TAF2K|TAFII18 |
| Gene description: | TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa |
| Genbank accession: | NM_005645 |
| Immunogen: | TAF13 (NP_005636.1, 27 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS |
| Protein accession: | NP_005636.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TAF13 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |