No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00006883-B01P |
Product name: | TAF12 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TAF12 protein. |
Gene id: | 6883 |
Gene name: | TAF12 |
Gene alias: | TAF2J|TAFII20 |
Gene description: | TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa |
Genbank accession: | BC011986 |
Immunogen: | TAF12 (AAH11986, 1 a.a. ~ 161 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK |
Protein accession: | AAH11986 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TAF12 expression in transfected 293T cell line (H00006883-T01) by TAF12 MaxPab polyclonal antibody. Lane1:TAF12 transfected lysate(17.82 KDa). Lane 2:Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |