| Brand: | Abnova |
| Reference: | H00006882-M06 |
| Product name: | TAF11 monoclonal antibody (M06), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF11. |
| Clone: | 3G6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6882 |
| Gene name: | TAF11 |
| Gene alias: | MGC:15243|PRO2134|TAF2I|TAFII28 |
| Gene description: | TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa |
| Genbank accession: | NM_005643 |
| Immunogen: | TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF |
| Protein accession: | NP_005634 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.46 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TAF11 monoclonal antibody (M06), clone 3G6 Western Blot analysis of TAF11 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |