| Brand: | Abnova |
| Reference: | H00006876-M06A |
| Product name: | TAGLN monoclonal antibody (M06A), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TAGLN. |
| Clone: | 3E6 |
| Isotype: | IgM Kappa |
| Gene id: | 6876 |
| Gene name: | TAGLN |
| Gene alias: | DKFZp686P11128|SM22|SMCC|TAGLN1|WS3-10 |
| Gene description: | transgelin |
| Genbank accession: | BC004927 |
| Immunogen: | TAGLN (AAH04927, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS |
| Protein accession: | AAH04927 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cross-Reacting Antibacterial Auto-Antibodies Are Produced within Coronary Atherosclerotic Plaques of Acute Coronary Syndrome Patients.Canducci F, Saita D, Foglieni C, Piscopiello MR, Chiesa R, Colombo A, Cianflone D, Maseri A, Clementi M, Burioni R. PLoS One. 2012;7(8):e42283. Epub 2012 Aug 6. |