| Brand: | Abnova |
| Reference: | H00006869-M10 |
| Product name: | TACR1 monoclonal antibody (M10), clone 1F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TACR1. |
| Clone: | 1F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6869 |
| Gene name: | TACR1 |
| Gene alias: | NK1R|NKIR|SPR|TAC1R |
| Gene description: | tachykinin receptor 1 |
| Genbank accession: | NM_001058 |
| Immunogen: | TACR1 (NP_001049, 140 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAK |
| Protein accession: | NP_001049 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TACR1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |