| Brand: | Abnova |
| Reference: | H00006868-M01 |
| Product name: | ADAM17 monoclonal antibody (M01), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAM17. |
| Clone: | 1F6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6868 |
| Gene name: | ADAM17 |
| Gene alias: | CD156b|MGC71942|TACE|cSVP |
| Gene description: | ADAM metallopeptidase domain 17 |
| Genbank accession: | NM_003183 |
| Immunogen: | ADAM17 (NP_003174, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV |
| Protein accession: | NP_003174 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ADAM17 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Increased expression of ALCAM/CD166 in pancreatic cancer is an independent prognostic marker for poor survival and early tumour relapse.Kahlert C, Weber H, Mogler C, Bergmann F, Schirmacher P, Kenngott HG, Matterne U, Mollberg N, Rahbari NN, Hinz U, Koch M, Aigner M, Weitz J. Br J Cancer. 2009 Aug 4;101(3):457-64. Epub 2009 Jul 14. |