No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006860-M04A |
Product name: | SYT4 monoclonal antibody (M04A), clone 5F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SYT4. |
Clone: | 5F8 |
Isotype: | IgG3 Kappa |
Gene id: | 6860 |
Gene name: | SYT4 |
Gene alias: | HsT1192|KIAA1342 |
Gene description: | synaptotagmin IV |
Genbank accession: | NM_020783.3 |
Immunogen: | SYT4 (NP_065834.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR |
Protein accession: | NP_065834.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SYT4 monoclonal antibody (M04A), clone 5F8 Western Blot analysis of SYT4 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |