View larger

SYT4 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of SYT4 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00006860-A01
Product name:	SYT4 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant SYT4.
Gene id:	6860
Gene name:	SYT4
Gene alias:	HsT1192\|KIAA1342
Gene description:	synaptotagmin IV
Genbank accession:	NM_020783
Immunogen:	SYT4 (NP_065834, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKR
Protein accession:	NP_065834
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Synaptotagmin-4 Expression in Mouse Horizontal Cells.Hirano AA, Morgans CW, Brecha NC. Invest. Ophthalmol. Vis. Sci., May 2007; 48: 2798.