| Brand: | Abnova |
| Reference: | H00006857-M01 |
| Product name: | SYT1 monoclonal antibody (M01), clone 3A5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SYT1. |
| Clone: | 3A5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6857 |
| Gene name: | SYT1 |
| Gene alias: | DKFZp781D2042|P65|SVP65|SYT |
| Gene description: | synaptotagmin I |
| Genbank accession: | BC058917 |
| Immunogen: | SYT1 (AAH58917, 1 a.a. ~ 422 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK |
| Protein accession: | AAH58917 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (72.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SYT1 monoclonal antibody (M01), clone 3A5. Western Blot analysis of SYT1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |