No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006843-M02 |
Product name: | VAMP1 monoclonal antibody (M02), clone 5A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VAMP1. |
Clone: | 5A4 |
Isotype: | IgG2a Lambda |
Gene id: | 6843 |
Gene name: | VAMP1 |
Gene alias: | DKFZp686H12131|SYB1|VAMP-1 |
Gene description: | vesicle-associated membrane protein 1 (synaptobrevin 1) |
Genbank accession: | NM_014231 |
Immunogen: | VAMP1 (NP_055046, 28 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK |
Protein accession: | NP_055046 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to VAMP1 on HepG2 cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |