| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00006837-B01 |
| Product name: | SURF5 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SURF5 protein. |
| Gene id: | 6837 |
| Gene name: | MED22 |
| Gene alias: | MED24|MGC48682|SURF5 |
| Gene description: | mediator complex subunit 22 |
| Genbank accession: | NM_181491 |
| Immunogen: | SURF5 (NP_852468, 1 a.a. ~ 140 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK |
| Protein accession: | NP_852468 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MED22 expression in transfected 293T cell line (H00006837-T01) by MED22 MaxPab polyclonal antibody. Lane 1: SURF5 transfected lysate(15.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Adenovirus L-E1A activates transcription through mediator complex dependent recruitment of the super elongation complex.Vijayalingam S, Chinnadurai G. J Virol. 2013 Jan 9. |