| Brand: | Abnova |
| Reference: | H00006829-M04A |
| Product name: | SUPT5H monoclonal antibody (M04A), clone 1G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SUPT5H. |
| Clone: | 1G3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6829 |
| Gene name: | SUPT5H |
| Gene alias: | FLJ34157|SPT5|SPT5H |
| Gene description: | suppressor of Ty 5 homolog (S. cerevisiae) |
| Genbank accession: | BC024203 |
| Immunogen: | SUPT5H (AAH24203, 981 a.a. ~ 1087 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA |
| Protein accession: | AAH24203 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SUPT5H monoclonal antibody (M04A), clone 1G3 Western Blot analysis of SUPT5H expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |