No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00006818-B02P |
Product name: | SULT1A3 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SULT1A3 protein. |
Gene id: | 6818 |
Gene name: | SULT1A3 |
Gene alias: | HAST|HAST3|M-PST|MGC117469|ST1A5|STM|SULT1A4|TL-PST |
Gene description: | sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3 |
Genbank accession: | NM_003166.3 |
Immunogen: | SULT1A3 (NP_003157.1, 1 a.a. ~ 295 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Protein accession: | NP_003157.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SULT1A3 expression in transfected 293T cell line (H00006818-T02) by SULT1A3 MaxPab polyclonal antibody. Lane 1: SULT1A3 transfected lysate(32.45 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |