| Brand: | Abnova |
| Reference: | H00006818-B01P |
| Product name: | SULT1A3 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SULT1A3 protein. |
| Gene id: | 6818 |
| Gene name: | SULT1A3 |
| Gene alias: | HAST|HAST3|M-PST|MGC117469|ST1A5|STM|SULT1A4|TL-PST |
| Gene description: | sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3 |
| Genbank accession: | BC014471 |
| Immunogen: | SULT1A3 (AAH14471, 1 a.a. ~ 295 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
| Protein accession: | AAH14471 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SULT1A3 MaxPab polyclonal antibody. Western Blot analysis of SULT1A3 expression in human liver. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |