Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00006817-D01P |
Product name: | SULT1A1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SULT1A1 protein. |
Gene id: | 6817 |
Gene name: | SULT1A1 |
Gene alias: | HAST1/HAST2|MGC131921|MGC5163|P-PST|PST|ST1A3|STP|STP1|TSPST1 |
Gene description: | sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 |
Genbank accession: | BC000923.2 |
Immunogen: | SULT1A1 (AAH00923.1, 1 a.a. ~ 295 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Protein accession: | AAH00923.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of SULT1A1 expression in transfected 293T cell line (H00006817-T02) by SULT1A1 MaxPab polyclonal antibody. Lane 1: SULT1A1 transfected lysate(34.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |