| Brand: | Abnova |
| Reference: | H00006804-A01 |
| Product name: | STX1A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant STX1A. |
| Gene id: | 6804 |
| Gene name: | STX1A |
| Gene alias: | HPC-1|STX1|p35-1 |
| Gene description: | syntaxin 1A (brain) |
| Genbank accession: | BC003011.1 |
| Immunogen: | STX1A (AAH03011.1, 1 a.a. ~ 251 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS |
| Protein accession: | AAH03011.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |