Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STK4 monoclonal antibody (M01), clone 1D7-8A10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about STK4 monoclonal antibody (M01), clone 1D7-8A10
| Brand: | Abnova |
| Reference: | H00006789-M01 |
| Product name: | STK4 monoclonal antibody (M01), clone 1D7-8A10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant STK4. |
| Clone: | 1D7-8A10 |
| Isotype: | IgG1 kappa |
| Gene id: | 6789 |
| Gene name: | STK4 |
| Gene alias: | DKFZp686A2068|KRS2|MST1|YSK3 |
| Gene description: | serine/threonine kinase 4 |
| Genbank accession: | BC005231 |
| Immunogen: | STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG |
| Protein accession: | AAH05231 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.03 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to STK4 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The mammalian STE20-like kinase 1 (MST1) is a substrate for the apoptosis inhibiting protein kinase CK2.Servas C, Kiehlmeier S, Hach J, Gross R, Gotz C, Montenarh M. Cell Signal. 2017 May 6;36:163-175. |