Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STK3 monoclonal antibody (M13), clone 4F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about STK3 monoclonal antibody (M13), clone 4F7
| Brand: | Abnova |
| Reference: | H00006788-M13 |
| Product name: | STK3 monoclonal antibody (M13), clone 4F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STK3. |
| Clone: | 4F7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6788 |
| Gene name: | STK3 |
| Gene alias: | FLJ90748|KRS1|MST2 |
| Gene description: | serine/threonine kinase 3 (STE20 homolog, yeast) |
| Genbank accession: | BC010640 |
| Immunogen: | STK3 (AAH10640.1, 311 a.a. ~ 431 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKV |
| Protein accession: | AAH10640.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.94 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of STK3 expression in transfected 293T cell line by STK3 monoclonal antibody (M13), clone 4F7. Lane 1: STK3 transfected lysate(56.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |