| Brand: | Abnova |
| Reference: | H00006788-M11 |
| Product name: | STK3 monoclonal antibody (M11), clone 1B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STK3. |
| Clone: | 1B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6788 |
| Gene name: | STK3 |
| Gene alias: | FLJ90748|KRS1|MST2 |
| Gene description: | serine/threonine kinase 3 (STE20 homolog, yeast) |
| Genbank accession: | NM_006281 |
| Immunogen: | STK3 (NP_006272.1, 253 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTM |
| Protein accession: | NP_006272.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | STK3 monoclonal antibody (M11), clone 1B3. Western Blot analysis of STK3 expression in Raw 264.7 ( Cat # L024V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |