Brand: | Abnova |
Reference: | H00006787-M01A |
Product name: | NEK4 monoclonal antibody (M01A), clone 1B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NEK4. |
Clone: | 1B8 |
Isotype: | IgG2a Kappa |
Gene id: | 6787 |
Gene name: | NEK4 |
Gene alias: | MGC33171|NRK2|STK2|pp12301 |
Gene description: | NIMA (never in mitosis gene a)-related kinase 4 |
Genbank accession: | BC063044 |
Immunogen: | NEK4 (AAH63044, 680 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF |
Protein accession: | AAH63044 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |