No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006782-M02 |
Product name: | STCH monoclonal antibody (M02), clone 1H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STCH. |
Clone: | 1H8 |
Isotype: | IgG2a Kappa |
Gene id: | 6782 |
Gene name: | HSPA13 |
Gene alias: | STCH |
Gene description: | heat shock protein 70kDa family, member 13 |
Genbank accession: | NM_006948 |
Immunogen: | STCH (NP_008879.3, 375 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNF |
Protein accession: | NP_008879.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | STCH monoclonal antibody (M02), clone 1H8. Western Blot analysis of STCH expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |