Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STAU1 monoclonal antibody (M04), clone 4D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA |
More info about STAU1 monoclonal antibody (M04), clone 4D6
| Brand: | Abnova |
| Reference: | H00006780-M04 |
| Product name: | STAU1 monoclonal antibody (M04), clone 4D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STAU1. |
| Clone: | 4D6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6780 |
| Gene name: | STAU1 |
| Gene alias: | FLJ25010|STAU |
| Gene description: | staufen, RNA binding protein, homolog 1 (Drosophila) |
| Genbank accession: | NM_004602 |
| Immunogen: | STAU1 (NP_004593, 401 a.a. ~ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC |
| Protein accession: | NP_004593 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to STAU1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |