Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of STAT3 monoclonal antibody (M02), clone 4D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
More info about STAT3 monoclonal antibody (M02), clone 4D6
| Brand: | Abnova |
| Reference: | H00006774-M02 |
| Product name: | STAT3 monoclonal antibody (M02), clone 4D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STAT3. |
| Clone: | 4D6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6774 |
| Gene name: | STAT3 |
| Gene alias: | APRF|FLJ20882|HIES|MGC16063 |
| Gene description: | signal transducer and activator of transcription 3 (acute-phase response factor) |
| Genbank accession: | NM_003150 |
| Immunogen: | STAT3 (NP_003141, 670 a.a. ~ 769 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM |
| Protein accession: | NP_003141 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to STAT3 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | EPHA3 regulates the multidrug resistance of small cell lung cancer via the PI3K/BMX/STAT3 sign.Peng J, Wang Q, Liu H, Ye M, Wu X, Guo L. Tumour Biol. 2016 Apr 21. [Epub ahead of print] |