Brand: | Abnova |
Reference: | H00006772-M01 |
Product name: | STAT1 monoclonal antibody (M01), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STAT1. |
Clone: | 1A8 |
Isotype: | IgG2a Kappa |
Gene id: | 6772 |
Gene name: | STAT1 |
Gene alias: | DKFZp686B04100|ISGF-3|STAT91 |
Gene description: | signal transducer and activator of transcription 1, 91kDa |
Genbank accession: | BC002704 |
Immunogen: | STAT1 (AAH02704, 613 a.a. ~ 712 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV |
Protein accession: | AAH02704 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | STAT1 monoclonal antibody (M01), clone 1A8 Western Blot analysis of STAT1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |