| Brand: | Abnova |
| Reference: | H00006742-M10 |
| Product name: | SSBP1 monoclonal antibody (M10), clone 4C1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SSBP1. |
| Clone: | 4C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6742 |
| Gene name: | SSBP1 |
| Gene alias: | SSBP |
| Gene description: | single-stranded DNA binding protein 1 |
| Genbank accession: | BC000895 |
| Immunogen: | SSBP1 (AAH00895, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE |
| Protein accession: | AAH00895 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SSBP1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Involvement of p53 in cell death following cell cycle arrest and mitotic catastrophe induced by rotenone.Goncalves AP, Maximo V, Lima J, Singh KK, Soares P, Videira A. Biochim Biophys Acta. 2011 Jan 9. [Epub ahead of print] |