SRP19 MaxPab mouse polyclonal antibody (B01) View larger

SRP19 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRP19 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SRP19 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006728-B01
Product name: SRP19 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SRP19 protein.
Gene id: 6728
Gene name: SRP19
Gene alias: -
Gene description: signal recognition particle 19kDa
Genbank accession: NM_003135
Immunogen: SRP19 (NP_003126, 1 a.a. ~ 144 a.a) full-length human protein.
Immunogen sequence/protein sequence: MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Protein accession: NP_003126
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006728-B01-13-15-1.jpg
Application image note: Western Blot analysis of SRP19 expression in transfected 293T cell line (H00006728-T01) by SRP19 MaxPab polyclonal antibody.

Lane 1: SRP19 transfected lysate(15.84 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SRP19 MaxPab mouse polyclonal antibody (B01) now

Add to cart