Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AKR1D1 monoclonal antibody (M03), clone 1C2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about AKR1D1 monoclonal antibody (M03), clone 1C2
| Brand: | Abnova |
| Reference: | H00006718-M03 |
| Product name: | AKR1D1 monoclonal antibody (M03), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKR1D1. |
| Clone: | 1C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 6718 |
| Gene name: | AKR1D1 |
| Gene alias: | 3o5bred|SRD5B1 |
| Gene description: | aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) |
| Genbank accession: | NM_005989 |
| Immunogen: | AKR1D1 (NP_005980, 227 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY |
| Protein accession: | NP_005980 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of AKR1D1 over-expressed 293 cell line, cotransfected with AKR1D1 Validated Chimera RNAi ( Cat # H00006718-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AKR1D1 monoclonal antibody (M03), clone 1C2 (Cat # H00006718-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |