| Brand: | Abnova |
| Reference: | H00006714-M01 |
| Product name: | SRC monoclonal antibody (M01), clone 1B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SRC. |
| Clone: | 1B9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6714 |
| Gene name: | SRC |
| Gene alias: | ASV|SRC1|c-SRC|p60-Src |
| Gene description: | v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) |
| Genbank accession: | BC011566 |
| Immunogen: | SRC (AAH11566, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFV |
| Protein accession: | AAH11566 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.90 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged SRC is approximately 30ng/ml as a capture antibody. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |