| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00006705-M03 |
| Product name: | SPRR2F monoclonal antibody (M03), clone 5A9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SPRR2F. |
| Clone: | 5A9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6705 |
| Gene name: | SPRR2F |
| Gene alias: | - |
| Gene description: | small proline-rich protein 2F |
| Genbank accession: | NM_001014450.1 |
| Immunogen: | SPRR2F (NP_001014450.1, 1 a.a. ~ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK |
| Protein accession: | NP_001014450.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SPRR2F expression in transfected 293T cell line by SPRR2F monoclonal antibody (M03), clone 5A9. Lane 1: SPRR2F transfected lysate(7.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |