SPR purified MaxPab mouse polyclonal antibody (B01P) View larger

SPR purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPR purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SPR purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00006697-B01P
Product name: SPR purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SPR protein.
Gene id: 6697
Gene name: SPR
Gene alias: SDR38C1
Gene description: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
Genbank accession: NM_003124.3
Immunogen: SPR (AAH17310.1, 1 a.a. ~ 261 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Protein accession: AAH17310.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006697-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SPR expression in transfected 293T cell line (H00006697-T01) by SPR MaxPab polyclonal antibody.

Lane1:SPR transfected lysate(28.71 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice
Publications: Novel Interaction of Ornithine Decarboxylase with Sepiapterin Reductase Regulates Neuroblastoma Cell Proliferation.Lange I, Geerts D, Feith DJ, Mocz G, Koster J, Bachmann AS
J Mol Biol. 2013 Oct 1. pii: S0022-2836(13)00621-9. doi: 10.1016/j.jmb.2013.09.037.

Reviews

Buy SPR purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart