Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SPR polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SPR polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006697-A01 |
| Product name: | SPR polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SPR. |
| Gene id: | 6697 |
| Gene name: | SPR |
| Gene alias: | SDR38C1 |
| Gene description: | sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) |
| Genbank accession: | NM_003124 |
| Immunogen: | SPR (NP_003115, 164 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD |
| Protein accession: | NP_003115 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SPR polyclonal antibody (A01), Lot # 060123JCO1 Western Blot analysis of SPR expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Valproic acid exposure leads to upregulation and increased promoter histone acetylation of sepiapterin reductase in a serotonergic cell line.Balasubramanian D, Deng AX, Doudney K, Hampton MB, Kennedy MA. Neuropharmacology. 2015 Jul 4. [Epub ahead of print] |