| Brand: | Abnova |
| Reference: | H00006696-M12A |
| Product name: | SPP1 monoclonal antibody (M12A), clone 3G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SPP1. |
| Clone: | 3G11 |
| Isotype: | IgG |
| Gene id: | 6696 |
| Gene name: | SPP1 |
| Gene alias: | BNSP|BSPI|ETA-1|MGC110940|OPN |
| Gene description: | secreted phosphoprotein 1 |
| Genbank accession: | NM_000582 |
| Immunogen: | SPP1 (NP_000573, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSR |
| Protein accession: | NP_000573 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |