| Brand: | Abnova |
| Reference: | H00006690-M01A |
| Product name: | SPINK1 monoclonal antibody (M01A), clone 4D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SPINK1. |
| Clone: | 4D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6690 |
| Gene name: | SPINK1 |
| Gene alias: | PCTT|PSTI|Spink3|TATI |
| Gene description: | serine peptidase inhibitor, Kazal type 1 |
| Genbank accession: | BC025790 |
| Immunogen: | SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC |
| Protein accession: | AAH25790 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SPINK1 monoclonal antibody (M01A), clone 4D4. Western Blot analysis of SPINK1 expression in human pancreas. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |