No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,IP |
| Brand: | Abnova |
| Reference: | H00006690-M01 |
| Product name: | SPINK1 monoclonal antibody (M01), clone 4D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SPINK1. |
| Clone: | 4D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6690 |
| Gene name: | SPINK1 |
| Gene alias: | PCTT|PSTI|Spink3|TATI |
| Gene description: | serine peptidase inhibitor, Kazal type 1 |
| Genbank accession: | BC025790 |
| Immunogen: | SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC |
| Protein accession: | AAH25790 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India.Ateeq B, Kunju LP, Carskadon SL, Pandey SK, Singh G, Pradeep I, Tandon V, Singhai A, Goel A, Amit S, Agarwal A, Dinda AK, Seth A, Tsodikov A, Chinnaiyan AM, Palanisamy N Prostate. 2015 Mar 23. doi: 10.1002/pros.22989. |