View larger

SPI1 monoclonal antibody (M02), clone 2G1

Reference:

Condition: New product

Data sheet of SPI1 monoclonal antibody (M02), clone 2G1

Brand:	Abnova
Reference:	H00006688-M02
Product name:	SPI1 monoclonal antibody (M02), clone 2G1
Product description:	Mouse monoclonal antibody raised against a partial recombinant SPI1.
Clone:	2G1
Isotype:	IgG1 Kappa
Gene id:	6688
Gene name:	SPI1
Gene alias:	OF\|PU.1\|SFPI1\|SPI-1\|SPI-A
Gene description:	spleen focus forming virus (SFFV) proviral integration oncogene spi1
Genbank accession:	NM_003120
Immunogen:	SPI1 (NP_003111, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP
Protein accession:	NP_003111
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (38.94 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human,Mouse
Application image:
Application image note:	Immunofluorescence of monoclonal antibody to SPI1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications:	WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice