Brand: | Abnova |
Reference: | H00006678-M04A |
Product name: | SPARC monoclonal antibody (M04A), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SPARC. |
Clone: | 1A2 |
Isotype: | IgG1 Kappa |
Gene id: | 6678 |
Gene name: | SPARC |
Gene alias: | ON |
Gene description: | secreted protein, acidic, cysteine-rich (osteonectin) |
Genbank accession: | BC004974 |
Immunogen: | SPARC (AAH04974.1, 1 a.a. ~ 303 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
Protein accession: | AAH04974.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (59.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SPARC monoclonal antibody (M04A), clone 1A2. Western Blot analysis of SPARC expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |