| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Brand: | Abnova |
| Reference: | H00006672-M02 |
| Product name: | SP100 monoclonal antibody (M02), clone 1G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SP100. |
| Clone: | 1G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6672 |
| Gene name: | SP100 |
| Gene alias: | DKFZp686E07254|FLJ00340|FLJ34579 |
| Gene description: | SP100 nuclear antigen |
| Genbank accession: | NM_003113 |
| Immunogen: | SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN |
| Protein accession: | NP_003104 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody (M02), clone 1G6. Lane 1: SP100 transfected lysate(100.417 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection.Berard AR, Coombs KM, Severini A J Proteome Res. 2015 Apr 15. |