| Brand: | Abnova |
| Reference: | H00006670-M07 |
| Product name: | SP3 monoclonal antibody (M07), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SP3. |
| Clone: | 2E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6670 |
| Gene name: | SP3 |
| Gene alias: | DKFZp686O1631|SPR-2 |
| Gene description: | Sp3 transcription factor |
| Genbank accession: | NM_003111 |
| Immunogen: | SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN* |
| Protein accession: | NP_003102 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SP3 monoclonal antibody (M07), clone 2E5 Western Blot analysis of SP3 expression in A-549 ( Cat # L025V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |