No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006667-A01 |
Product name: | SP1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SP1. |
Gene id: | 6667 |
Gene name: | SP1 |
Gene alias: | - |
Gene description: | Sp1 transcription factor |
Genbank accession: | NM_138473 |
Immunogen: | SP1 (NP_612482, 89 a.a. ~ 198 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ |
Protein accession: | NP_612482 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Functional relevance of the BMD-associated polymorphism rs312009: novel involvement of Runx2 in LRP5 transcriptional regulation.Agueda L, Velazquez-Cruz R, Urreizti R, Yoskovitz G, Sarrion P, Jurado S, Guerri R, Garcia-Giralt N, Nogues X, Mellibovsky L, Diez-Perez A, Marie PJ, Balcells S, Grinberg D. J Bone Miner Res. 2010 Nov 18. [Epub ahead of print] |