Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00006667-A01 |
| Product name: | SP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SP1. |
| Gene id: | 6667 |
| Gene name: | SP1 |
| Gene alias: | - |
| Gene description: | Sp1 transcription factor |
| Genbank accession: | NM_138473 |
| Immunogen: | SP1 (NP_612482, 89 a.a. ~ 198 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ |
| Protein accession: | NP_612482 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Functional relevance of the BMD-associated polymorphism rs312009: novel involvement of Runx2 in LRP5 transcriptional regulation.Agueda L, Velazquez-Cruz R, Urreizti R, Yoskovitz G, Sarrion P, Jurado S, Guerri R, Garcia-Giralt N, Nogues X, Mellibovsky L, Diez-Perez A, Marie PJ, Balcells S, Grinberg D. J Bone Miner Res. 2010 Nov 18. [Epub ahead of print] |